PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016461216.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 488aa    MW: 53112.3 Da    PI: 8.2525
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016461216.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-1665109147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT+eE+ ++++a+k++G   W++I +++g ++t+ q++s+ qk+
   XP_016461216.1  65 RERWTEEEHRKFLEAIKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 109
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-1659113IPR009057Homeodomain-like
PROSITE profilePS5129422.43760114IPR017930Myb domain
TIGRFAMsTIGR015572.5E-1763112IPR006447Myb domain, plants
SMARTSM007171.2E-1364112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-1065105IPR009057Homeodomain-like
PfamPF002498.1E-1465108IPR001005SANT/Myb domain
CDDcd001677.92E-1167110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MASAEMADQD QSGESGVDSI RSSWNGISSD VGASSTRSIQ LKEQVASADE YAPKARKAYT  60
ISKQRERWTE EEHRKFLEAI KLYGRAWRRI EEHVGTKTAV QIRSHAQKFF SKVVRESNSG  120
DASSVKPIEI PPPRPKRKPM HPYPRKLATP VKSGTLVPEK LTRSISPNMS MSEQENQSPT  180
SVLSAHGSDA LGTGDSSKRS GSASPVSSAG GGNSDGFVLS EPPNFILQDS STPAQANAST  240
NPENQACVKL ELLPQEGSAE TSSTPCLKLF GKTVLVTESQ RPCPTSGTCK IETDVNDEAA  300
LPTASWNIMP MKFTASDSDC VSSTLTMGTP PPFYYLPSQN ENQWPTRCAS ATLLPWGSSC  360
ASVSFPCIQV LNPIPIKGRP IFNDNNLEDK QNQKEGSSTG SNTEPVSTEM SGDKNMDVEA  420
QSSQHPLEKV RKELSSRPSE TSSLVRRASS TKRIKGFVPY KRCLAERGTN SSRLSGEERE  480
EQRTRLCM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016461216.10.0PREDICTED: protein REVEILLE 1-like isoform X1
TrEMBLM1BXP30.0M1BXP3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000552630.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31852447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.17e-55MYB_related family protein